site stats

Synpcc7942_rs03485

WebThe freshwater cyanobacterium Synechococcus elongatus PCC 7942 holds a special place in the development of cyanobacterial molecular genetics. It was this isolate, previously … WebSYNPCC7942_RS00385 secondary thiamine-phosphate synthase enzyme YjbQ [] Gene ID: 76398824, updated on 18-Nov-2024. Summary Other designations. secondary thiamine ...

Identification of two two-component signal transduction

WebSYNPCC7942_RS00645 [ Synechococcus elongatus PCC 7942 = FACHB-805 ] Genome viewer. Functional annotations. Analysis tools. Gene information. Genome. SynE … WebSynpcc7942_1420 Enzymes [BR:syf01000] 1. Oxidoreductases 1.3 Acting on the CH-CH group of donors 1.3.7 With an iron-sulfur protein as acceptor 1.3.7.7 … commentary\u0027s sk https://balbusse.com

BiGG Gene SYNPCC7942_RS03585

Websynpcc7942_0050 and 400bp upstream of synpcc7942_0607, and constructed two corresponding PTR-only candidates: ST09 and ST35. We started with JRC35 (21), which … WebSynpcc7942_0049 Secretion system [BR:syf02044] Type II secretion system Pilin secretion/fimbrial assembly protein Synpcc7942_0049 Bacterial motility proteins … WebSYNPCC7942_1420 (SynelCyc) SYNPCC7942_RS07265 P54208 (UniProt) Length: 1401 bp / 466 aa: Map Position: Reaction: chlorophyllide a + 2 an oxidized ferredoxin [iron-sulfur] … dry shampoo industry

Synechococcus elongatus PCC 7942 erg3

Category:Transcriptome landscape of Synechococcus elongatus PCC 7942 …

Tags:Synpcc7942_rs03485

Synpcc7942_rs03485

SYNPCC7942_RS08915 HEAT repeat domain-containing protein []

WebSynpcc7942_0699 Latest BiGG Models publication: King ZA, Lu JS, Dräger A, Miller PC, Federowicz S, Lerman JA, Ebrahim A, Palsson BO, and Lewis NE. BiGG Models: A platform … WebThe Synechococcus sp. PCC 7942 spermidine synthase encoded by spds gene (Synpcc7942_0628) is responsible for spermidine biosynthesis. Two Synechococcus …

Synpcc7942_rs03485

Did you know?

WebSYNPCC7942_1050 (SynelCyc) SYNPCC7942_RS05385 Q31PD9 (UniProt) Length: 870 bp / 289 aa: Map Position: Location: thylakoid membrane : Report Errors or Provide Feedback … WebSynpcc7942_2006 Imported. Organism names. Organism. Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805) (Anacystis nidulans R2) Imported. Taxonomic …

WebDec 1, 2016 · S. elongatus synpcc7942_0469 is the only gene encoding an iPGM, and it is essential in vivo. Thus, synpcc7942_0469 was annotated as the primary glycolytic PGM in … WebYour Current Organism: Synechococcus elongatus PCC7942. NCBI taxonomy Id: 1140. Other names: Anacystis nidulans R2, S. elongatus PCC 7942, Synechococcus elongatus PCC …

Webgene sequence: atgacctaca cagcggcctc cctcaaagcg gaattgaacg agcgaggctg gcgattgacg cctcagcgcg aagaaattct gcgagtcttt caaaatctcc cagcaggtga acacctcagt http://bigg.ucsd.edu/models/iJB785/genes/SYNPCC7942_RS03585

WebAug 4, 2016 · However, expressions of the glnA (Synpcc7942_2156) gene encoding for the type I GS and the glsF (Synpcc7942_0890) gene encoding for a ferredoxin-dependent …

WebSYNPCC7942_RS00810 Q31RX7 (UniProt) Length: 936 bp / 311 aa: Map Position: Locations: inner membrane , cytosol : Report Errors or Provide Feedback Page generated by Pathway … dry shampoo ingredientsWebPurchase Recombinant Synechococcus elongatus Maf-like protein Synpcc7942_0209(Synpcc7942_0209). It is produced in Yeast. High purity. Good price. dry shampooingWebAug 4, 2016 · Another regulon of N tcA is the glnA (Synpcc7942_2156) and gl nB (Synpcc7942_0321) genes encoding for glu- tamine synthase (GS) and P II protein, r … commentary\u0027s smWebNucleoside triphosphate pyrophosphatase. Status. UniProtKB reviewed (Swiss-Prot) Organism. Synechococcus elongatus (strain PCC 7942 / FACHB-805) (Anacystis nidulans … commentary\u0027s swWebSYNPCC7942_0680 (SynelCyc) SYNPCC7942_RS03485 Q31QF7 (UniProt) Length: 816 bp / 271 aa: Map Position: Location: membrane : Report Errors or Provide Feedback Page … dry shampoo issuesWebtable: begin end state 1 28 signal peptide 29 443 non-cytoplasmic input: >synpcc7942_rs06350 msqfsrrkflltaggtaaaalwlnacgsnnsstdttgststpapsgtsggdapevkgvtl ... commentary\u0027s srWebThe various serial-datacom protocols range from RS-232 (EIA/TIA-232) to Gigabit Ethernet, and beyond. Though each protocol suits a particular application, in all cases you must … dry shampoo ingredients for hair